Lineage for d1vscb2 (1vsc B:1-90)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54436Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)
  7. 54437Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)
  8. 54441Domain d1vscb2: 1vsc B:1-90 [21688]
    Other proteins in same PDB: d1vsca1, d1vscb1

Details for d1vscb2

PDB Entry: 1vsc (more details), 1.9 Å

PDB Description: vcam-1

SCOP Domain Sequences for d1vscb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vscb2 b.1.1.4 (B:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

SCOP Domain Coordinates for d1vscb2:

Click to download the PDB-style file with coordinates for d1vscb2.
(The format of our PDB-style files is described here.)

Timeline for d1vscb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vscb1