Lineage for d3tkyb2 (3tky B:123-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893124Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2893164Protein automated matches [226979] (4 species)
    not a true protein
  7. 2893165Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries)
  8. 2893181Domain d3tkyb2: 3tky B:123-367 [216860]
    Other proteins in same PDB: d3tkya1, d3tkyb1, d3tkyc1, d3tkyd1
    automated match to d1kyzc2
    complexed with n7i, sah

Details for d3tkyb2

PDB Entry: 3tky (more details), 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkyb2 c.66.1.12 (B:123-367) automated matches {Clarkia breweri [TaxId: 36903]}
dgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkg
mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda
pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi
lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm
eflkt

SCOPe Domain Coordinates for d3tkyb2:

Click to download the PDB-style file with coordinates for d3tkyb2.
(The format of our PDB-style files is described here.)

Timeline for d3tkyb2: