Lineage for d1vcab2 (1vca B:1-90)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1519052Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)
  7. 1519053Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)
  8. 1519055Domain d1vcab2: 1vca B:1-90 [21686]
    Other proteins in same PDB: d1vcaa1, d1vcab1
    D1

Details for d1vcab2

PDB Entry: 1vca (more details), 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
PDB Compounds: (B:) human vascular cell adhesion molecule-1

SCOPe Domain Sequences for d1vcab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcab2 b.1.1.4 (B:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

SCOPe Domain Coordinates for d1vcab2:

Click to download the PDB-style file with coordinates for d1vcab2.
(The format of our PDB-style files is described here.)

Timeline for d1vcab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcab1