![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (25 proteins) |
![]() | Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) |
![]() | Domain d1vcab2: 1vca B:1-90 [21686] Other proteins in same PDB: d1vcaa1, d1vcab1 |
PDB Entry: 1vca (more details), 1.8 Å
SCOP Domain Sequences for d1vcab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcab2 b.1.1.4 (B:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)} fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp vsfgnehsylctatcesrklekgiqveiys
Timeline for d1vcab2: