SCOP 1.59: Domain d1vcab2: 1vca B:1-90

Lineage for d1vcab2 (1vca B:1-90)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)

8. Domain d1vcab2: 1vca B:1-90 [21686]
   Other proteins in same PDB: d1vcaa1, d1vcab1

Details for d1vcab2

PDB Entry: 1vca, 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

SCOP Domain Sequences for d1vcab2:

Sequence; same for both SEQRES and ATOM records:

>d1vcab2 b.1.1.4 (B:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

Timeline for d1vcab2:

• d1vcab2 first appeared (with stable ids) in SCOP 1.55
  
• d1vcab2 appears in SCOP 1.57
  
• d1vcab2 appears in SCOP 1.61
  
• d1vcab2 appears in the current release, SCOPe 2.08