Lineage for d3tkya1 (3tky A:16-122)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1479988Species Clarkia breweri [TaxId:36903] [226317] (2 PDB entries)
  8. 1479993Domain d3tkya1: 3tky A:16-122 [216857]
    Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2
    automated match to d1kyze1
    complexed with n7i, sah

Details for d3tkya1

PDB Entry: 3tky (more details), 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (A:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkya1 a.4.5.0 (A:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

SCOPe Domain Coordinates for d3tkya1:

Click to download the PDB-style file with coordinates for d3tkya1.
(The format of our PDB-style files is described here.)

Timeline for d3tkya1: