Lineage for d3tkca_ (3tkc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729577Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2729578Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 2729580Domain d3tkca_: 3tkc A: [216853]
    automated match to d1ie9a_
    complexed with fmv, so4

Details for d3tkca_

PDB Entry: 3tkc (more details), 1.75 Å

PDB Description: Design, Synthesis, Evaluation and Structure of Vitamin D Analogues with Furan Side Chains
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3tkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkca_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOPe Domain Coordinates for d3tkca_:

Click to download the PDB-style file with coordinates for d3tkca_.
(The format of our PDB-style files is described here.)

Timeline for d3tkca_: