![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) |
![]() | Domain d1vcaa2: 1vca A:1-90 [21685] Other proteins in same PDB: d1vcaa1, d1vcab1 D1 |
PDB Entry: 1vca (more details), 1.8 Å
SCOPe Domain Sequences for d1vcaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp vsfgnehsylctatcesrklekgiqveiys
Timeline for d1vcaa2: