SCOPe 2.04: Domain d1vcaa2: 1vca A:1-90

Lineage for d1vcaa2 (1vca A:1-90)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries)

8. Domain d1vcaa2: 1vca A:1-90 [21685]
   Other proteins in same PDB: d1vcaa1, d1vcab1
   D1

Details for d1vcaa2

PDB Entry: 1vca, 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

PDB Compounds: (A:) human vascular cell adhesion molecule-1

SCOPe Domain Sequences for d1vcaa2:

Sequence; same for both SEQRES and ATOM records:

>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

Timeline for d1vcaa2:

• d1vcaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1vcaa2 appears in SCOPe 2.03
  
• d1vcaa2 appears in SCOPe 2.05
  
• d1vcaa2 appears in the current release, SCOPe 2.08