Lineage for d1vcaa2 (1vca A:1-90)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9513Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species)
  7. 9514Species Human (Homo sapiens) [TaxId:9606] [49161] (2 PDB entries)
  8. 9515Domain d1vcaa2: 1vca A:1-90 [21685]
    Other proteins in same PDB: d1vcaa1, d1vcab1

Details for d1vcaa2

PDB Entry: 1vca (more details), 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

SCOP Domain Sequences for d1vcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcaa2 b.1.1.4 (A:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys

SCOP Domain Coordinates for d1vcaa2:

Click to download the PDB-style file with coordinates for d1vcaa2.
(The format of our PDB-style files is described here.)

Timeline for d1vcaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcaa1