Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (4 PDB entries) |
Domain d3tjza_: 3tjz A: [216849] automated match to d1vg9b_ complexed with gnp, mg |
PDB Entry: 3tjz (more details), 2.9 Å
SCOPe Domain Sequences for d3tjza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjza_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisftvwdvggqdrirsl wrhyyrntegvifvvdsndrsrigearevmqrmlnedelrnaawlvfankqdlpeamsaa eiteklglhsirnrpwfiqatcatsgeglyeglewlsns
Timeline for d3tjza_: