![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD80, second domain [49157] (1 species) a soluble form of b7-1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries) |
![]() | Domain d1dr9a2: 1dr9 A:106-200 [21684] Other proteins in same PDB: d1dr9a1 complexed with nag |
PDB Entry: 1dr9 (more details), 3 Å
SCOPe Domain Sequences for d1dr9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya vsskldfnmttnhsfmclikyghlrvnqtfnwnta
Timeline for d1dr9a2: