Lineage for d1dr9a2 (1dr9 A:106-200)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290164Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 290200Protein CD80, second domain [49157] (1 species)
    a soluble form of b7-1
  7. 290201Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)
  8. 290202Domain d1dr9a2: 1dr9 A:106-200 [21684]
    Other proteins in same PDB: d1dr9a1
    complexed with nag

Details for d1dr9a2

PDB Entry: 1dr9 (more details), 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)

SCOP Domain Sequences for d1dr9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens)}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnta

SCOP Domain Coordinates for d1dr9a2:

Click to download the PDB-style file with coordinates for d1dr9a2.
(The format of our PDB-style files is described here.)

Timeline for d1dr9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dr9a1