Lineage for d1dr9a2 (1dr9 A:106-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753523Protein CD80, second domain [49157] (1 species)
    a soluble form of b7-1
  7. 2753524Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)
  8. 2753525Domain d1dr9a2: 1dr9 A:106-200 [21684]
    Other proteins in same PDB: d1dr9a1
    complexed with nag

Details for d1dr9a2

PDB Entry: 1dr9 (more details), 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)
PDB Compounds: (A:) t lymphocyte activation antigen

SCOPe Domain Sequences for d1dr9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnta

SCOPe Domain Coordinates for d1dr9a2:

Click to download the PDB-style file with coordinates for d1dr9a2.
(The format of our PDB-style files is described here.)

Timeline for d1dr9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dr9a1