SCOPe 2.08: Domain d3tjel2: 3tje L:112-213

Lineage for d3tjel2 (3tje L:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3tjel2: 3tje L:112-213 [216838]
   Other proteins in same PDB: d3tjeh_, d3tjel1
   automated match to d1aqkl2
   complexed with cd, cl, edo

Details for d3tjel2

PDB Entry: 3tje, 1.93 Å

PDB Description: crystal structure of fas receptor extracellular domain in complex with fab e09

PDB Compounds: (L:) Fab E09, light chain

SCOPe Domain Sequences for d3tjel2:

Sequence; same for both SEQRES and ATOM records:

>d3tjel2 b.1.1.2 (L:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d3tjel2:

• d3tjel2 first appeared in SCOPe 2.03
  
• d3tjel2 appears in SCOPe 2.07