SCOPe 2.06: Domain d3tjel1: 3tje L:1-111

Lineage for d3tjel1 (3tje L:1-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3tjel1: 3tje L:1-111 [216837]
   Other proteins in same PDB: d3tjel2
   automated match to d1aqkl1
   complexed with cd, cl, edo

Details for d3tjel1

PDB Entry: 3tje, 1.93 Å

PDB Description: crystal structure of fas receptor extracellular domain in complex with fab e09

PDB Compounds: (L:) Fab E09, light chain

SCOPe Domain Sequences for d3tjel1:

Sequence; same for both SEQRES and ATOM records:

>d3tjel1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvseaprqtvtiscsgnsfnigrypvnwyqqlpgkapklliyynnlrfsgvs
drfsgsksgtsaslairdllsedeadyycstwddtlkgwvfgggtkvtvlg

Timeline for d3tjel1:

• d3tjel1 first appeared in SCOPe 2.03
  
• d3tjel1 appears in SCOPe 2.05
  
• d3tjel1 appears in SCOPe 2.07
  
• d3tjel1 appears in the current release, SCOPe 2.08