SCOPe 2.05: Domain d3thml2: 3thm L:112-214

Lineage for d3thml2 (3thm L:112-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3thml2: 3thm L:112-214 [216824]
   Other proteins in same PDB: d3thml1
   automated match to d1aqkl2
   complexed with edo

Details for d3thml2

PDB Entry: 3thm, 2.1 Å

PDB Description: crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01

PDB Compounds: (L:) Fab EP6b_B01, light chain

SCOPe Domain Sequences for d3thml2:

Sequence; same for both SEQRES and ATOM records:

>d3thml2 b.1.1.2 (L:112-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d3thml2:

• d3thml2 first appeared in SCOPe 2.03
  
• d3thml2 appears in SCOPe 2.04
  
• d3thml2 appears in SCOPe 2.06
  
• d3thml2 appears in the current release, SCOPe 2.08