Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [194783] (4 PDB entries) |
Domain d3thaa1: 3tha A:1-247 [216821] Other proteins in same PDB: d3thaa2, d3thab2 automated match to d1wdwa1 |
PDB Entry: 3tha (more details), 2.37 Å
SCOPe Domain Sequences for d3thaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3thaa1 c.1.2.0 (A:1-247) automated matches {Campylobacter jejuni [TaxId: 192222]} mvdfrkfykenanvaytvlgypnlqtseaflqrldqspidilelgvaysdpiadgeiiad aakialdqgvdihsvfellariktkkalvfmvyynlifsyglekfvkkakslgicalivp elsfeesddlikecerynialitlvsvttpkervkklvkhakgfiyllasigitgtksve eailqdkvkeirsftnlpifvgfgiqnnqdvkrmrkvadgvivgtsivkcfkqgnldiim kdieeif
Timeline for d3thaa1: