SCOPe 2.08: Domain d3thaa1: 3tha A:1-247

Lineage for d3thaa1 (3tha A:1-247)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (36 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [194783] (4 PDB entries)

8. Domain d3thaa1: 3tha A:1-247 [216821]
   Other proteins in same PDB: d3thaa2, d3thab2
   automated match to d1wdwa1

Details for d3thaa1

PDB Entry: 3tha, 2.37 Å

PDB Description: Tryptophan synthase subunit alpha from Campylobacter jejuni.

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d3thaa1:

Sequence; same for both SEQRES and ATOM records:

>d3thaa1 c.1.2.0 (A:1-247) automated matches {Campylobacter jejuni [TaxId: 192222]}
mvdfrkfykenanvaytvlgypnlqtseaflqrldqspidilelgvaysdpiadgeiiad
aakialdqgvdihsvfellariktkkalvfmvyynlifsyglekfvkkakslgicalivp
elsfeesddlikecerynialitlvsvttpkervkklvkhakgfiyllasigitgtksve
eailqdkvkeirsftnlpifvgfgiqnnqdvkrmrkvadgvivgtsivkcfkqgnldiim
kdieeif

Timeline for d3thaa1:

• d3thaa1 first appeared in SCOPe 2.03, called d3thaa_
  
• d3thaa1 appears in SCOPe 2.07