SCOP 1.57: Domain d1hngb2: 1hng B:100-176

Lineage for d1hngb2 (1hng B:100-176)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD2, second domain [49152] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49154] (1 PDB entry)

8. Domain d1hngb2: 1hng B:100-176 [21682]
   Other proteins in same PDB: d1hnga1, d1hngb1

Details for d1hngb2

PDB Entry: 1hng, 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2

SCOP Domain Sequences for d1hngb2:

Sequence; same for both SEQRES and ATOM records:

>d1hngb2 b.1.1.3 (B:100-176) CD2, second domain {Rat (Rattus norvegicus)}
mvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkcka
vnrvsqesemevvncpe

Timeline for d1hngb2:

• d1hngb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hngb2 appears in SCOP 1.59
  
• d1hngb2 appears in the current release, SCOPe 2.08