Lineage for d1hnga2 (1hng A:100-176)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9356Protein CD2, second domain [49152] (2 species)
  7. 9359Species Rat (Rattus norvegicus) [TaxId:10116] [49154] (1 PDB entry)
  8. 9360Domain d1hnga2: 1hng A:100-176 [21681]
    Other proteins in same PDB: d1hnga1, d1hngb1

Details for d1hnga2

PDB Entry: 1hng (more details), 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2

SCOP Domain Sequences for d1hnga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnga2 b.1.1.3 (A:100-176) CD2, second domain {Rat (Rattus norvegicus)}
mvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkcka
vnrvsqesemevvncpe

SCOP Domain Coordinates for d1hnga2:

Click to download the PDB-style file with coordinates for d1hnga2.
(The format of our PDB-style files is described here.)

Timeline for d1hnga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnga1