Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD2, second domain [49152] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49153] (1 PDB entry) |
Domain d1hnf_2: 1hnf 105-182 [21680] Other proteins in same PDB: d1hnf_1 complexed with na, nag |
PDB Entry: 1hnf (more details), 2.5 Å
SCOP Domain Sequences for d1hnf_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnf_2 b.1.1.3 (105-182) CD2, second domain {Human (Homo sapiens)} rvskpkiswtcinttltcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkcta gnkvskessvepvscpek
Timeline for d1hnf_2: