Lineage for d1cida2 (1cid A:106-177)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295282Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1295292Protein CD4 C2-set domains [49149] (2 species)
  7. 1295334Species Rat (Rattus rattus) [TaxId:10117] [49151] (1 PDB entry)
  8. 1295335Domain d1cida2: 1cid A:106-177 [21679]
    Other proteins in same PDB: d1cida1
    domain 4
    complexed with so4

Details for d1cida2

PDB Entry: 1cid (more details), 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cida2 b.1.1.3 (A:106-177) CD4 C2-set domains {Rat (Rattus rattus) [TaxId: 10117]}
vmkvtqpdsntltcevmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllse
geevkmdskiqv

SCOPe Domain Coordinates for d1cida2:

Click to download the PDB-style file with coordinates for d1cida2.
(The format of our PDB-style files is described here.)

Timeline for d1cida2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cida1