![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [49151] (1 PDB entry) |
![]() | Domain d1cida2: 1cid A:106-177 [21679] Other proteins in same PDB: d1cida1 domain 4 complexed with so4 |
PDB Entry: 1cid (more details), 2.8 Å
SCOPe Domain Sequences for d1cida2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cida2 b.1.1.3 (A:106-177) CD4 C2-set domains {Rat (Rattus rattus) [TaxId: 10117]} vmkvtqpdsntltcevmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllse geevkmdskiqv
Timeline for d1cida2: