Lineage for d1wiqb4 (1wiq B:292-363)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656760Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 656770Protein CD4 C2-set domains [49149] (2 species)
  7. 656771Species Human (Homo sapiens) [TaxId:9606] [49150] (25 PDB entries)
  8. 656805Domain d1wiqb4: 1wiq B:292-363 [21678]
    Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2
    domains 2 and 4

Details for d1wiqb4

PDB Entry: 1wiq (more details), 5 Å

PDB Description: structure of t-cell surface glycoprotein cd4, trigonal crystal form
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1wiqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiqb4 b.1.1.3 (B:292-363) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wiqb4:

Click to download the PDB-style file with coordinates for d1wiqb4.
(The format of our PDB-style files is described here.)

Timeline for d1wiqb4: