Lineage for d1wiqb4 (1wiq B:292-363)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160328Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 160338Protein CD4 [49149] (2 species)
  7. 160339Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 160361Domain d1wiqb4: 1wiq B:292-363 [21678]
    Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2

Details for d1wiqb4

PDB Entry: 1wiq (more details), 5 Å

PDB Description: structure of t-cell surface glycoprotein cd4, trigonal crystal form

SCOP Domain Sequences for d1wiqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiqb4 b.1.1.3 (B:292-363) CD4 {Human (Homo sapiens)}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wiqb4:

Click to download the PDB-style file with coordinates for d1wiqb4.
(The format of our PDB-style files is described here.)

Timeline for d1wiqb4: