Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
Protein automated matches [195455] (14 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries) |
Domain d3td4d1: 3td4 D:221-339 [216760] Other proteins in same PDB: d3td4a2, d3td4b2, d3td4c2, d3td4d2, d3td4e2, d3td4f2, d3td4g2, d3td4h2 automated match to d2hqsc_ complexed with api |
PDB Entry: 3td4 (more details), 1.79 Å
SCOPe Domain Sequences for d3td4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3td4d1 d.79.7.0 (D:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]} eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr
Timeline for d3td4d1: