Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries) |
Domain d1wiqa4: 1wiq A:292-363 [21676] Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2 |
PDB Entry: 1wiq (more details), 5 Å
SCOP Domain Sequences for d1wiqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiqa4 b.1.1.3 (A:292-363) CD4 C2-set domains {Human (Homo sapiens)} mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg qvllesnikvlp
Timeline for d1wiqa4:
View in 3D Domains from other chains: (mouse over for more information) d1wiqb1, d1wiqb2, d1wiqb3, d1wiqb4 |