Lineage for d1wiqa4 (1wiq A:292-363)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366293Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 366303Protein CD4 C2-set domains [49149] (2 species)
  7. 366304Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)
  8. 366326Domain d1wiqa4: 1wiq A:292-363 [21676]
    Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2

Details for d1wiqa4

PDB Entry: 1wiq (more details), 5 Å

PDB Description: structure of t-cell surface glycoprotein cd4, trigonal crystal form

SCOP Domain Sequences for d1wiqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiqa4 b.1.1.3 (A:292-363) CD4 C2-set domains {Human (Homo sapiens)}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wiqa4:

Click to download the PDB-style file with coordinates for d1wiqa4.
(The format of our PDB-style files is described here.)

Timeline for d1wiqa4: