Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (6 species) not a true protein |
Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries) |
Domain d3tc2b_: 3tc2 B: [216731] automated match to d1ba7a_ |
PDB Entry: 3tc2 (more details), 1.6 Å
SCOPe Domain Sequences for d3tc2b_:
Sequence, based on SEQRES records: (download)
>d3tc2b_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} datpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsg tpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggti gqadsswfkivkssqfgynllycpvttssddqfclkvgvvhqngkrrlalvkdnpldvsf kqvq
>d3tc2b_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} datpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsg tpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggti gqadsswfkivkssqfgynllycpvfclkvgvvhqngkrrlalvkdnpldvsfkqvq
Timeline for d3tc2b_: