Lineage for d3tc2b_ (3tc2 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062422Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries)
  8. 2062424Domain d3tc2b_: 3tc2 B: [216731]
    automated match to d1ba7a_

Details for d3tc2b_

PDB Entry: 3tc2 (more details), 1.6 Å

PDB Description: Crystal structure of potato serine protease inhibitor.
PDB Compounds: (B:) Kunitz-type proteinase inhibitor P1H5

SCOPe Domain Sequences for d3tc2b_:

Sequence, based on SEQRES records: (download)

>d3tc2b_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
datpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsg
tpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggti
gqadsswfkivkssqfgynllycpvttssddqfclkvgvvhqngkrrlalvkdnpldvsf
kqvq

Sequence, based on observed residues (ATOM records): (download)

>d3tc2b_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
datpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsg
tpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggti
gqadsswfkivkssqfgynllycpvfclkvgvvhqngkrrlalvkdnpldvsfkqvq

SCOPe Domain Coordinates for d3tc2b_:

Click to download the PDB-style file with coordinates for d3tc2b_.
(The format of our PDB-style files is described here.)

Timeline for d3tc2b_: