SCOPe 2.04: Domain d3tblc1: 3tbl C:1-126

Lineage for d3tblc1 (3tbl C:1-126)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
   Uniprot P12004

8. Domain d3tblc1: 3tbl C:1-126 [216726]
   Other proteins in same PDB: d3tbld_, d3tble_
   automated match to d1u7ba1

Details for d3tblc1

PDB Entry: 3tbl, 2.9 Å

PDB Description: structure of mono-ubiquitinated pcna: implications for dna polymerase switching and okazaki fragment maturation

PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3tblc1:

Sequence; same for both SEQRES and ATOM records:

>d3tblc1 d.131.1.2 (C:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d3tblc1:

• d3tblc1 first appeared in SCOPe 2.03
  
• d3tblc1 appears in SCOPe 2.05
  
• d3tblc1 appears in the current release, SCOPe 2.08