![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries) Uniprot P12004 |
![]() | Domain d3tblc1: 3tbl C:1-126 [216726] Other proteins in same PDB: d3tbld_, d3tble_ automated match to d1u7ba1 |
PDB Entry: 3tbl (more details), 2.9 Å
SCOPe Domain Sequences for d3tblc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tblc1 d.131.1.2 (C:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd ldveql
Timeline for d3tblc1: