Lineage for d3tblb1 (3tbl B:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977098Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
    Uniprot P12004
  8. 2977147Domain d3tblb1: 3tbl B:1-126 [216724]
    Other proteins in same PDB: d3tbld_, d3tble_
    automated match to d1u7ba1

Details for d3tblb1

PDB Entry: 3tbl (more details), 2.9 Å

PDB Description: structure of mono-ubiquitinated pcna: implications for dna polymerase switching and okazaki fragment maturation
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3tblb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tblb1 d.131.1.2 (B:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d3tblb1:

Click to download the PDB-style file with coordinates for d3tblb1.
(The format of our PDB-style files is described here.)

Timeline for d3tblb1: