Lineage for d3tbla1 (3tbl A:1-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216000Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2216043Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
    Uniprot P12004
  8. 2216078Domain d3tbla1: 3tbl A:1-126 [216722]
    Other proteins in same PDB: d3tbld_, d3tble_
    automated match to d1u7ba1

Details for d3tbla1

PDB Entry: 3tbl (more details), 2.9 Å

PDB Description: Structure of Mono-ubiquitinated PCNA: Implications for DNA Polymerase Switching and Okazaki Fragment Maturation
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3tbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tbla1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d3tbla1:

Click to download the PDB-style file with coordinates for d3tbla1.
(The format of our PDB-style files is described here.)

Timeline for d3tbla1: