Lineage for d1wipa4 (1wip A:292-363)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 550420Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 550430Protein CD4 C2-set domains [49149] (2 species)
  7. 550431Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)
  8. 550449Domain d1wipa4: 1wip A:292-363 [21672]
    Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2

Details for d1wipa4

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form

SCOP Domain Sequences for d1wipa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipa4 b.1.1.3 (A:292-363) CD4 C2-set domains {Human (Homo sapiens)}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wipa4:

Click to download the PDB-style file with coordinates for d1wipa4.
(The format of our PDB-style files is described here.)

Timeline for d1wipa4: