| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.3: C2 set domains [49142] (8 proteins) |
| Protein CD4 C2-set domains [49149] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49150] (25 PDB entries) |
| Domain d1wipa3: 1wip A:98-178 [21671] Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2 |
PDB Entry: 1wip (more details), 4 Å
SCOP Domain Sequences for d1wipa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wipa3 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla
Timeline for d1wipa3:
View in 3DDomains from other chains: (mouse over for more information) d1wipb1, d1wipb2, d1wipb3, d1wipb4 |