SCOPe 2.08: Domain d3t9ja_: 3t9j A:

Lineage for d3t9ja_ (3t9j A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)

8. Domain d3t9ja_: 3t9j A: [216708]
   automated match to d2cf7a_
   complexed with edo

Details for d3t9ja_

PDB Entry: 3t9j, 2.2 Å

PDB Description: Crystal structure HP-NAP from strain YS39 in apo form

PDB Compounds: (A:) Neutrophil-activating protein

SCOPe Domain Sequences for d3t9ja_:

Sequence; same for both SEQRES and ATOM records:

>d3t9ja_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyegfadmfddlaeriaq
lghhplvtlsealkltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

Timeline for d3t9ja_:

• d3t9ja_ first appeared in SCOPe 2.03
  
• d3t9ja_ appears in SCOPe 2.07