![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries) |
![]() | Domain d1wiob4: 1wio B:292-363 [21670] Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2 domains 2 and 4 |
PDB Entry: 1wio (more details), 3.9 Å
SCOPe Domain Sequences for d1wiob4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiob4 b.1.1.3 (B:292-363) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg qvllesnikvlp
Timeline for d1wiob4:
![]() Domains from other chains: (mouse over for more information) d1wioa1, d1wioa2, d1wioa3, d1wioa4 |