Lineage for d1wioa4 (1wio A:292-363)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656760Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 656770Protein CD4 C2-set domains [49149] (2 species)
  7. 656771Species Human (Homo sapiens) [TaxId:9606] [49150] (25 PDB entries)
  8. 656795Domain d1wioa4: 1wio A:292-363 [21668]
    Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2

Details for d1wioa4

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1wioa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wioa4 b.1.1.3 (A:292-363) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wioa4:

Click to download the PDB-style file with coordinates for d1wioa4.
(The format of our PDB-style files is described here.)

Timeline for d1wioa4: