Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries) |
Domain d1wioa4: 1wio A:292-363 [21668] Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2 |
PDB Entry: 1wio (more details), 3.9 Å
SCOP Domain Sequences for d1wioa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wioa4 b.1.1.3 (A:292-363) CD4 C2-set domains {Human (Homo sapiens)} mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg qvllesnikvlp
Timeline for d1wioa4:
View in 3D Domains from other chains: (mouse over for more information) d1wiob1, d1wiob2, d1wiob3, d1wiob4 |