Lineage for d1wioa4 (1wio A:292-363)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104668Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 104678Protein CD4 [49149] (2 species)
  7. 104679Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 104691Domain d1wioa4: 1wio A:292-363 [21668]
    Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2

Details for d1wioa4

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form

SCOP Domain Sequences for d1wioa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wioa4 b.1.1.3 (A:292-363) CD4 {Human (Homo sapiens)}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wioa4:

Click to download the PDB-style file with coordinates for d1wioa4.
(The format of our PDB-style files is described here.)

Timeline for d1wioa4: