SCOPe 2.08: Domain d3t4ea1: 3t4e A:6-106

Lineage for d3t4ea1 (3t4e A:6-106)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226189] (1 PDB entry)

8. Domain d3t4ea1: 3t4e A:6-106 [216676]
   Other proteins in same PDB: d3t4ea2, d3t4eb2
   automated match to d1npda2
   complexed with nad, po4

Details for d3t4ea1

PDB Entry: 3t4e, 1.95 Å

PDB Description: 1.95 angstrom crystal structure of shikimate 5-dehydrogenase (aroe) from salmonella enterica subsp. enterica serovar typhimurium in complex with nad

PDB Compounds: (A:) Quinate/shikimate dehydrogenase

SCOPe Domain Sequences for d3t4ea1:

Sequence; same for both SEQRES and ATOM records:

>d3t4ea1 c.58.1.0 (A:6-106) automated matches {Salmonella enterica [TaxId: 90371]}
kyeliglmaypirhslspemqnkalekaglpytymafevdnttfasaieglkalkmrgtg
vsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

Timeline for d3t4ea1:

• d3t4ea1 first appeared in SCOPe 2.03
  
• d3t4ea1 appears in SCOPe 2.07