Lineage for d3t3mf1 (3t3m F:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760312Domain d3t3mf1: 3t3m F:1-107 [216663]
    Other proteins in same PDB: d3t3ma_, d3t3mc_, d3t3me_, d3t3mf2, d3t3mh_, d3t3ml2
    automated match to d1dqdl1
    complexed with ca, cl, nag, rc2, so4

Details for d3t3mf1

PDB Entry: 3t3m (more details), 2.6 Å

PDB Description: a novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
PDB Compounds: (F:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3t3mf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t3mf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d3t3mf1:

Click to download the PDB-style file with coordinates for d3t3mf1.
(The format of our PDB-style files is described here.)

Timeline for d3t3mf1: