Lineage for d3t3ma_ (3t3m A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2076199Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2076200Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2076201Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2076202Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
    Uniprot P08514 32-483
  8. 2076217Domain d3t3ma_: 3t3m A: [216661]
    Other proteins in same PDB: d3t3mf1, d3t3mf2, d3t3ml1, d3t3ml2
    automated match to d3fcua_
    complexed with ca, cl, nag, rc2, so4

Details for d3t3ma_

PDB Entry: 3t3m (more details), 2.6 Å

PDB Description: a novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d3t3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t3ma_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d3t3ma_:

Click to download the PDB-style file with coordinates for d3t3ma_.
(The format of our PDB-style files is described here.)

Timeline for d3t3ma_: