Class b: All beta proteins [48724] (176 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) |
Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins) |
Protein Integrin alpha N-terminal domain [69320] (2 species) |
Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (18 PDB entries) Uniprot P08514 32-483 |
Domain d3t3ma_: 3t3m A: [216661] Other proteins in same PDB: d3t3mf1, d3t3mf2, d3t3ml1, d3t3ml2 automated match to d3fcua_ complexed with ca, cl, nag, rc2, so4 |
PDB Entry: 3t3m (more details), 2.6 Å
SCOPe Domain Sequences for d3t3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3ma_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs lrgavdiddngypdlivgayganqvavyraqpvv
Timeline for d3t3ma_: