Lineage for d3t2nl2 (3t2n L:109-209)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517733Domain d3t2nl2: 3t2n L:109-209 [216647]
    Other proteins in same PDB: d3t2nl1, d3t2nm1
    automated match to d1aqkl2

Details for d3t2nl2

PDB Entry: 3t2n (more details), 2.55 Å

PDB Description: Human hepsin protease in complex with the Fab fragment of an inhibitory antibody
PDB Compounds: (L:) Antibody, Fab fragment, Light Chain

SCOPe Domain Sequences for d3t2nl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2nl2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d3t2nl2:

Click to download the PDB-style file with coordinates for d3t2nl2.
(The format of our PDB-style files is described here.)

Timeline for d3t2nl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t2nl1