SCOPe 2.04: Domain d3t2nl1: 3t2n L:1-108

Lineage for d3t2nl1 (3t2n L:1-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3t2nl1: 3t2n L:1-108 [216646]
   Other proteins in same PDB: d3t2nl2, d3t2nm2
   automated match to d1aqkl1

Details for d3t2nl1

PDB Entry: 3t2n, 2.55 Å

PDB Description: Human hepsin protease in complex with the Fab fragment of an inhibitory antibody

PDB Compounds: (L:) Antibody, Fab fragment, Light Chain

SCOPe Domain Sequences for d3t2nl1:

Sequence; same for both SEQRES and ATOM records:

>d3t2nl1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtvvtqepsltvspggtvtltcrsstgavttsnyanwvqqkpgqafrgligdtnnrapwt
parfsgsllggkaaltlsgvqpedeaeyycalwysnhfifgsgtkvtvlg

Timeline for d3t2nl1:

• d3t2nl1 first appeared in SCOPe 2.03
  
• d3t2nl1 appears in SCOPe 2.05
  
• d3t2nl1 appears in the current release, SCOPe 2.08