SCOP 1.75: Domain d1cdja2: 1cdj A:98-178

Lineage for d1cdja2 (1cdj A:98-178)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)

8. Domain d1cdja2: 1cdj A:98-178 [21664]
   Other proteins in same PDB: d1cdja1
   domain 2

Details for d1cdja2

PDB Entry: 1cdj, 2.5 Å

PDB Description: structure of t-cell surface glycoprotein cd4

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1cdja2:

Sequence; same for both SEQRES and ATOM records:

>d1cdja2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1cdja2:

• d1cdja2 first appeared (with stable ids) in SCOP 1.55, called d1cdj_2
  
• d1cdja2 appears in SCOP 1.73
  
• d1cdja2 appears in SCOPe 2.01
  
• d1cdja2 appears in the current release, SCOPe 2.08