SCOPe 2.04: Domain d3t0xb_: 3t0x B:

Lineage for d3t0xb_ (3t0x B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3t0xb_: 3t0x B: [216632]
   automated match to d2e7lc_
   complexed with diw, edo, so4

Details for d3t0xb_

PDB Entry: 3t0x, 1.96 Å

PDB Description: fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red

PDB Compounds: (B:) Immunoglobulin variable lambda domain M8VLA4(S55P)

SCOPe Domain Sequences for d3t0xb_:

Sequence; same for both SEQRES and ATOM records:

>d3t0xb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrpsgvp
drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtv

Timeline for d3t0xb_:

• d3t0xb_ first appeared in SCOPe 2.03
  
• d3t0xb_ appears in SCOPe 2.05
  
• d3t0xb_ appears in the current release, SCOPe 2.08