Lineage for d3t0wb_ (3t0w B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754530Domain d3t0wb_: 3t0w B: [216630]
    automated match to d2e7lc_
    complexed with cl, diw, pe3

Details for d3t0wb_

PDB Entry: 3t0w (more details), 1.5 Å

PDB Description: fluorogen activating protein m8vl in complex with dimethylindole red
PDB Compounds: (B:) immunoglobulin variable lambda domain

SCOPe Domain Sequences for d3t0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0wb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp
drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvld

SCOPe Domain Coordinates for d3t0wb_:

Click to download the PDB-style file with coordinates for d3t0wb_.
(The format of our PDB-style files is described here.)

Timeline for d3t0wb_: