Lineage for d3szja_ (3szj A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325518Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1325519Protein automated matches [190537] (7 species)
    not a true protein
  7. 1325561Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 1325584Domain d3szja_: 3szj A: [216621]
    automated match to d3szig_
    complexed with acy, btn, co3, gol

Details for d3szja_

PDB Entry: 3szj (more details), 1.45 Å

PDB Description: Structure of the shwanavidin-biotin complex
PDB Compounds: (A:) Avidin/streptavidin

SCOPe Domain Sequences for d3szja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szja_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
amaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtai
sfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts

SCOPe Domain Coordinates for d3szja_:

Click to download the PDB-style file with coordinates for d3szja_.
(The format of our PDB-style files is described here.)

Timeline for d3szja_: