Lineage for d3swod2 (3swo D:244-396)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708612Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries)
  8. 2708616Domain d3swod2: 3swo D:244-396 [216595]
    Other proteins in same PDB: d3swoa1, d3swob1, d3swoc1, d3swod1
    automated match to d1siqa1
    complexed with edo, fda, unx

Details for d3swod2

PDB Entry: 3swo (more details), 1.45 Å

PDB Description: crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3swod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swod2 a.29.3.0 (D:244-396) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtve
lgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplr
hannlesvltyegtsemhllsigkaltgkaafr

SCOPe Domain Coordinates for d3swod2:

Click to download the PDB-style file with coordinates for d3swod2.
(The format of our PDB-style files is described here.)

Timeline for d3swod2: